SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H7R2X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H7R2X2
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily YcfC-like 1.96e-65
Family YcfC-like 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H7R2X2
Sequence length 209
Comment (tr|A0A1H7R2X2|A0A1H7R2X2_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome OX=1396821 OS=Ectothiorhodospira marina. GN=SAMN05444515_12034 OC=Ectothiorhodospiraceae; Ectothiorhodospira.
Sequence
MESSHHNRALALAALFQSAAMVKDIAWHGRCDLDQLQTMVGSLFAFEANTIESVYGGVDH
LERGLRTLLEQIQSPSHQVDAEISRYVISVLHLERKLMKNPQMIKTLRDGVDAASHQSEA
FGMTHENIMARLGETYQNTISELGPRIIVQGDQSHLGNSNNAARIRTLLLAGIRAAVLWR
QAGGSRWRLIFSRNAIVAEAKGILDRIVE
Download sequence
Identical sequences A0A1H7R2X2
WP_090255385.1.11453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]