SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H9IRA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H9IRA3
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily YcfC-like 2.75e-64
Family YcfC-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H9IRA3
Sequence length 223
Comment (tr|A0A1H9IRA3|A0A1H9IRA3_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695} KW=Complete proteome; Reference proteome OX=355243 OS=Amphritea atlantica. GN=SAMN03080615_02714 OC=Oceanospirillaceae; Amphritea.
Sequence
MSRAEDQQAIALAGLFQAASLVEQIATRGMVSQNSFETSLASIFVTNPQTTEEIFGGVHD
LPINLSQGFRGLQELLDKSRADQNQDIIRYGLSLIHLERKLNKRPDLLKVIGERIDKIAQ
QASYFAEAGTSLKDNPAAYTHPSVVANLASLYQDTLSTFSFRIQVTGEPRHLQNAENAAK
IRALLLAGIRSAMLWRQVGGKRWHLLFFKSRLRPSVRQISGRD
Download sequence
Identical sequences A0A1H9IRA3
WP_091359152.1.62484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]