SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H9TBP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1H9TBP3
Domain Number - Region: 83-130
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00667
Family E6 C-terminal domain-like 0.014
Further Details:      
 
Domain Number - Region: 4-91
Classification Level Classification E-value
Superfamily Rhomboid-like 0.085
Family Rhomboid-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H9TBP3
Sequence length 174
Comment (tr|A0A1H9TBP3|A0A1H9TBP3_9PSED) Electron transport complex protein RnfE {ECO:0000313|EMBL:SER94581.1} KW=Complete proteome OX=1306993 OS=Pseudomonas soli. GN=SAMN05216230_11522 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSRFWLVMISLAPLLGATRTIVQAIAISLCACLLTGLHQALMAPLRSHLAQGASLWASAL
LTATLVTCLHLGLRAWALPLAEQLALYPLLLALPCLACEQLLPQTHRYRQLCRGLGGLLV
ASLALGICRQVLADDLGLHIATLAPGALILLGLLLGLYNHLRPSTTSPRRLGSR
Download sequence
Identical sequences A0A088NP38 A0A1H9TBP3
WP_023630759.1.17606 WP_023630759.1.3973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]