SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I0A6Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I0A6Q4
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00000000000017
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I0A6Q4
Sequence length 201
Comment (tr|A0A1I0A6Q4|A0A1I0A6Q4_NITER) Anti sigma-E protein, RseA {ECO:0000313|EMBL:SES89856.1} KW=Complete proteome OX=915 OS=Nitrosomonas europaea. GN=SAMN05216309_10857 OC=Nitrosomonadaceae; Nitrosomonas.
Sequence
MVTRGEIVRNKVSELMDGELDGTHAAKIINAVKTDNDLFSDWKIYHAIGDSLRQSAVNID
ISEQVRNQLADEPLLLSPYPHKTHQNRKQKLLGLSVAASVAALSIGWLISQSMEQHETTL
KEIYVAEKNNGKTAPVGGPRSLMTFQPVSAYSSPSMPVNTHYNNDPLIYRDLTYERSVRY
PATGISSPAEVVGEQSAASAE
Download sequence
Identical sequences A0A1I0A6Q4 Q82SJ2
WP_011112814.1.11244 WP_011112814.1.14462 WP_011112814.1.55826 WP_011112814.1.61914 228410.NE2330 gi|30250257|ref|NP_842327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]