SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I1X4Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I1X4Y0
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00000000994
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I1X4Y0
Sequence length 186
Comment (tr|A0A1I1X4Y0|A0A1I1X4Y0_9ALTE) Sigma-E factor negative regulatory protein RseA {ECO:0000313|EMBL:SFE02485.1} KW=Complete proteome OX=1761793 OS=Marinobacter sp. DSM 26671. GN=SAMN04487869_102189 OC=Alteromonadaceae; Marinobacter.
Sequence
MDDRLRETLSAMMDDEADELSVRRLLSHDRQDEVRAQWQRWQDVRDLMHDGHSPAHGMDV
SVGVRERLDGRGTTAVRPEAAVQATRSGRWHWPAAAMVAMALLVGFGAGAGWDSSATGPV
QPVTAAAPETPVQDQPVREIALQGLDEEQWEYMSRYLLEHAQHNSVGAGRGAVGYARLVS
ANGAGY
Download sequence
Identical sequences A0A1I1X4Y0 A0A2E8LQD0 E4PQJ7 G6YXI5
WP_008176205.1.11983 WP_008176205.1.19098 WP_008176205.1.58462 gi|385330517|ref|YP_005884468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]