SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I2H271 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I2H271
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.15e-39
Family Frataxin-like 0.000000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I2H271
Sequence length 107
Comment (tr|A0A1I2H271|A0A1I2H271_9ENTR) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=1855371 OS=Kosakonia sp. S29. GN=SAMN05216563_11747 OC=Enterobacteriaceae; Kosakonia.
Sequence
MNDSEFHRLADTLWMTIEERLDDWDGDSDIDCEINGGILTITFENGSKIIINRQEPLHQV
WLAAKQGGYHFDLKGDEWVCDRSGETFWDLLEQAATQQAGEKVSFRG
Download sequence
Identical sequences A0A1I2H271
WP_090088463.1.8249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]