SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3F5L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1I3F5L0
Domain Number - Region: 10-90
Classification Level Classification E-value
Superfamily BEACH domain 0.00301
Family BEACH domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I3F5L0
Sequence length 132
Comment (tr|A0A1I3F5L0|A0A1I3F5L0_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:SFI06519.1} KW=Complete proteome; Reference proteome OX=34004 OS=Paracoccus aminovorans. GN=SAMN04488021_16210 OC=Rhodobacteraceae; Paracoccus.
Sequence
MTEASESCVRDPSNYRDRSADWYAFYDERRRKEIIDIIDEHPEIVEEHAANPFGYRKHPS
PYLQRVHNYFRMQPTFGKYYIYSEREWDAYRIATIREFGELPELGDERFKTEEEAMHAVF
LRRIEDVRAELA
Download sequence
Identical sequences A0A1I3F5L0 Q9LCC1 V5LKX0
WP_062563510.1.65298 WP_062563510.1.79144 WP_062563510.1.93944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]