SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I4GU82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I4GU82
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily FlaG-like 8.24e-24
Family FlaG-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I4GU82
Sequence length 127
Comment (tr|A0A1I4GU82|A0A1I4GU82_DESNO) Flagellar protein FlaG {ECO:0000313|EMBL:SFL32907.1} KW=Complete proteome OX=52561 OS=desulfuricans (strain Norway 4)). GN=SAMN05421830_101623 OC=Desulfomicrobiaceae; Desulfomicrobium.
Sequence
MKITSLSYEPQELLAPVEQTNQLKSDFEDAERAASGGLQGRQSGATPDESEEISAQKLQN
LTEAVDSYMSSLGVNLKFHIDERTDTVQVEVRDPETQKLIRKIPADEMLDLAVSIEKMVG
LFLDKAL
Download sequence
Identical sequences A0A1I4GU82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]