SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7LYH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1I7LYH1
Domain Number - Region: 3-50
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.051
Family Bcl-2 inhibitors of programmed cell death 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I7LYH1
Sequence length 54
Comment (tr|A0A1I7LYH1|A0A1I7LYH1_9RHIZ) Pilus assembly protein Flp/PilA {ECO:0000313|EMBL:SFV14647.1} KW=Complete proteome OX=1502759 OS=Methylobacterium sp. UNCCL125. GN=SAMN02799643_06144 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MKTLFTRFASDESGATAIEYGMIAALIAVAIITALKTVGTSLTSKFSQISGNLN
Download sequence
Identical sequences A0A089NZ18 A0A0E9KDC9 A0A0M8ZB93 A0A0N0TWV5 A0A154NC56 A0A1H5VAT2 A0A1I6RPV2 A0A1I7LYH1 A0A2E7YKQ3 B1LTV3
426355.Mrad2831_3495 gi|170749895|ref|YP_001756155.1| WP_012320434.1.100277 WP_012320434.1.17008 WP_012320434.1.25698 WP_012320434.1.3059 WP_012320434.1.30774 WP_012320434.1.31760 WP_012320434.1.35747 WP_012320434.1.45562 WP_012320434.1.47484 WP_012320434.1.49077 WP_012320434.1.5195 WP_012320434.1.61980 WP_012320434.1.64777 WP_012320434.1.64947 WP_012320434.1.86888 WP_012320434.1.89921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]