SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7SKK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7SKK6
Domain Number 1 Region: 11-201
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-78
Family BEACH domain 0.000000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I7SKK6
Sequence length 202
Comment (tr|A0A1I7SKK6|A0A1I7SKK6_BURXY) Uncharacterized protein {ECO:0000313|WBParaSite:BXY_1358600.1} KW=Complete proteome; Reference proteome OX=6326 OS=xylophilus). GN= OC=Tylenchomorpha; Aphelenchoidea; Aphelenchoididae; Bursaphelenchus.
Sequence
XRPFELTNFFQDYDSDSLDLTKPCTFRDLSKPMGAQTPERLAQFLKRFREWDDPSGDTPP
YMYGTHYSSAMIVLSYLVRLEPFTQQFLKLQGGHFDLADRMFHSVGDAFKSAAKNNMADV
KELIPEFFYLPEMFKNSNSYDLGVKQNGVPLNDIILPAWAHGDPIEFVRKHREALESDYV
SEHLHEWIDLIFGFKQNGEAAK
Download sequence
Identical sequences A0A1I7SKK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]