SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7T018 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7T018
Domain Number 1 Region: 4-45
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000445
Family Integrin beta tail domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I7T018
Sequence length 119
Comment (tr|A0A1I7T018|A0A1I7T018_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold427.g1146.t1} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
XLNETTPCQFVDPADDCTFYYLYYYDEATDNATVWVRRHKDCPPPVPVLAIVLGVIAGIV
ILGILLLLLWKLLTVLHDRAEYAKFNNERLLAKWDTNENPIYKQATTTFKNPVYSGKNN
Download sequence
Identical sequences A0A1I7T018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]