SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7YB07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7YB07
Domain Number 1 Region: 53-197
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 9.94e-37
Family Troponin I 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I7YB07
Sequence length 210
Comment (tr|A0A1I7YB07|A0A1I7YB07_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:L893_g1429.t1} KW=Complete proteome; Reference proteome OX=37863 OS=Steinernema glaseri. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Steinernematidae; Steinernema.
Sequence
MAADPELLRYGGPQNDSEDEEEKKAAELRERKKAEVRKRLEEASRAKKSKKGFLTPERKK
KLRKLLMMKTAEALRQKQEEMERERQRILQERIMPLPDLDSFDEDELQTSLKEMYDRVVE
LESESYDINLKVRAKDFEINELTIAVNDLRGKFVKPTLKKVSKTEGKFNKLKKKEGPKVD
FRAQLKMVDTQKFTMKEDEGKGAGKAEWAK
Download sequence
Identical sequences A0A1I7YB07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]