SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1I8GH92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8GH92
Domain Number 1 Region: 6-218
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-67
Family Capz beta-1 subunit 0.0000000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8GH92
Sequence length 218
Comment (tr|A0A1I8GH92|A0A1I8GH92_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-uti_cns_0001888-snap-gene-0.20-mRNA-1, ECO:0000313|WBParaSite:maker-uti_cns_0014549-snap-gene-0.2-mRNA-1, ECO:0000313|WBParaSite:maker-uti_cns_0014648-snap-gene-0.3-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MDAGDRRLNCALDMMRRLPPQEVEANLAHLIDLVPDLTENLLCSVDQPLKVARDSSCNKD
YLLCDYNRDADSYRSPWSNKYDPPLEDGTVPSDRLRSLEIDLNSAMEQYQDLYFGGGISS
AYLWDMDNGFAGVVLIKKIGDAARTRGQWDSIHVVEVAHKIGGRSAKYKLTATTMLWVRT
ADTAAGEFDIGGSLTRQVEKEATVADMQAHIFTIGRMI
Download sequence
Identical sequences A0A1I8GH92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]