SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J0RQR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J0RQR9
Domain Number 1 Region: 62-160
Classification Level Classification E-value
Superfamily FlaG-like 2.48e-21
Family FlaG-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J0RQR9
Sequence length 161
Comment (tr|A0A1J0RQR9|A0A1J0RQR9_9ALTE) Flagellar biosynthesis protein FlaG {ECO:0000313|EMBL:APD85440.1} KW=Complete proteome OX=1917157 OS=Alteromonas sp. Mex14. GN=BM527_04720 OC=Alteromonadaceae; Alteromonas.
Sequence
MEIQNTQVGQPFASPGPKNVGVIESDVKSELSISQDNERSLNGGQNTNVNAATNESNKTE
SQQILSQASPSQADINEAKRNGIELDDAIAKVESFLKVQNRDLAFTIDENTNRSVVTVKD
STSGDVIRQIPSEEVLKLADRIQELQQDVGDSVGVFINNQV
Download sequence
Identical sequences A0A1J0RQR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]