SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3CUB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3CUB9
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.31e-32
Family P-domain of calnexin/calreticulin 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J3CUB9
Sequence length 89
Comment (tr|A0A1J3CUB9|A0A1J3CUB9_NOCCA) Calreticulin {ECO:0000313|EMBL:JAU11402.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=GA_TR19171_c0_g1_i1_g.61444 OC=Coluteocarpeae; Noccaea.
Sequence
VDETHIDDPEDVKPEGYDEIPAEINDPEAAKPADWDDELDGEWEAPKVPNPEFKGPWRAK
RIPNPAYKGAWVHPLIANPNYVADPTIYS
Download sequence
Identical sequences A0A1J3CUB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]