SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3D0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3D0U4
Domain Number 1 Region: 237-305
Classification Level Classification E-value
Superfamily XPC-binding domain 1.83e-23
Family XPC-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.53e-20
Family Ubiquitin-related 0.00076
Further Details:      
 
Domain Number 3 Region: 303-365
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000047
Family UBA domain 0.0025
Further Details:      
 
Domain Number 4 Region: 141-193
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000426
Family UBA domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J3D0U4
Sequence length 368
Comment (tr|A0A1J3D0U4|A0A1J3D0U4_NOCCA) Ubiquitin receptor RAD23b {ECO:0000313|EMBL:JAU13594.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=GA_TR6452_c0_g1_i1_g.21418 OC=Coluteocarpeae; Noccaea.
Sequence
MKLTVKTLKGSHFEIRVLPSETIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETTLV
ENKVTEEGFLVVMLSKSKSGGSAAQSSAQPASATTSTTSSTTPAAPSTTQSTAVPASPIP
AQEQPAAQTDTYGQAASTLVSGSTLEQMVQQLMDMGGGSWDKETVTRALRAAYNNPERAV
DYLYSGIPETAEVAVAVPGAQMAGSGAAPVAPASGGPNSSPLDLFPQETVAAPGTGDLGT
LDFLRNNDQFQQLRTMVHSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLVNEPYEGS
DGDADMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFDRALVVEAFLACDRNEELAANYLL
ENSGDFED
Download sequence
Identical sequences A0A1J3D0U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]