SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3DA02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3DA02
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily BEACH domain 0.0000000000000183
Family BEACH domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J3DA02
Sequence length 124
Comment (tr|A0A1J3DA02|A0A1J3DA02_NOCCA) BEACH domain-containing protein lvsA {ECO:0000313|EMBL:JAU14581.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=GA_TR3423_c14_g1_i1_g.10742 OC=Coluteocarpeae; Noccaea.
Sequence
GKAAEKSVNVFYHYTYEGNVDVDAVTDPTLKASILAQINHFGQTPKQLFQKPHVKRRTDR
KIPLHPLKHSMHLVPREIRKCSSSINQIITFHDKLLVSASNCFLKPRGYRKYIRWGFPDR
SLRF
Download sequence
Identical sequences A0A1J3DA02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]