SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3F4S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3F4S2
Domain Number 1 Region: 171-221
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-23
Family BEACH domain 0.00036
Further Details:      
 
Domain Number 2 Region: 3-31,93-143
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000676
Family PreBEACH PH-like domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J3F4S2
Sequence length 221
Comment (tr|A0A1J3F4S2|A0A1J3F4S2_NOCCA) WD repeat and FYVE domain-containing protein 3 {ECO:0000313|EMBL:JAU36580.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=LC_TR2920_c2_g1_i1_g.11631 OC=Coluteocarpeae; Noccaea.
Sequence
LIGELCLYVIENFYLNDDGCICEKECEDELSIIDQALGVKKQLTGSLDVQSKSSPLWSTT
TKTGAVGGRAWAYGCGAWGKEKVRVTGNLPHPWRRWKLDNVHEILKRDYELRPVAVEIFS
MDGCNDLLVFHKKEREEVFRNLLAMNLPRNRMLDTTISGSAKQESKEGSRLFKLMAKSFT
KRWQNGEISNFQYLMHLNTLAGRGYSDLTQYPVFPWILSDY
Download sequence
Identical sequences A0A1J3F4S2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]