SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4LS62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4LS62
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Hypothetical protein YojF 1.57e-49
Family Hypothetical protein YojF 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J4LS62
Sequence length 116
Comment (tr|A0A1J4LS62|A0A1J4LS62_9BACL) Uncharacterized protein {ECO:0000313|EMBL:OHX57187.1} OX=622695 OS=Planococcus salinarum. GN=BB776_00095 OC=Planococcus.
Sequence
MELVEMKKLQVQLDAFAGKDVYLHLETTNGSYASHFNEAFFNAGAFIRNVVINYELGKVI
GDSPHRVGLKLPHGWVYAQGITHYEMDEQGRLLLAGHDGTGKLAVALQISETPFSY
Download sequence
Identical sequences A0A1J4LS62
WP_071151756.1.64550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]