SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J5CBD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J5CBD6
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily AF1782-like 0.00000000000000405
Family AF1782-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J5CBD6
Sequence length 81
Comment (tr|A0A1J5CBD6|A0A1J5CBD6_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:OIP20292.1} KW=Complete proteome; Reference proteome OX=1805398 OS=archaeon CG2_30_31_98. GN=AUJ91_01595 OC=Archaea.
Sequence
MVSTKEHLKKETIKWLNKLDNLDIKLKNPKKHGFLKNIKAYIKDSHYFTEKEDFVRAFEA
VVWAWAWVEIGEQEGFLEIKK
Download sequence
Identical sequences A0A1J5CBD6 A0A2G9LIX0 A0A2H9M2F3 A0A2H9M7P6 A0A2H9MM40 A0A2H9N308 A0A2H9P8S9 A0A2H9QT10 A0A2H9RCI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]