SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J5M994 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J5M994
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Barstar-related 0.000000000235
Family Barstar-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J5M994
Sequence length 91
Comment (tr|A0A1J5M994|A0A1J5M994_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:OIQ36233.1} OX=1860084 OS=Crocinitomix sp. MedPE-SWsnd. GN=BM555_03075 OC=Crocinitomicaceae; Crocinitomix.
Sequence
MIIDLGNINSPQELHLKLKTAFHFGDDYGMNWESFIVFLKAEEDNLPYEVTLRNWKILER
DFPTDAELFKEKIADFNRDSLESEIGIEQVF
Download sequence
Identical sequences A0A1J5M994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]