SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J9V505 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J9V505
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily NosL/MerB-like 6.28e-28
Family NosL-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J9V505
Sequence length 167
Comment (tr|A0A1J9V505|A0A1J9V505_BACAN) Uncharacterized protein {ECO:0000313|EMBL:OJD86320.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=BVG01_21940 OC=Bacillus cereus group.
Sequence
MRTKYVMFAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGVMDNQFATEIILENGK
ALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWVSLEDATYVYDKTITTPMAYNVISF
KNKKDAENFVSNYKGKVLSYKELAEHKWEMNKEMMGNPKKGNHGGHH
Download sequence
Identical sequences A0A0G8DBT9 A0A0K6MH03 A0A154B2E0 A0A1J9V505
WP_001259394.1.101931 WP_001259394.1.11387 WP_001259394.1.12289 WP_001259394.1.15163 WP_001259394.1.16013 WP_001259394.1.20665 WP_001259394.1.29804 WP_001259394.1.33536 WP_001259394.1.45919 WP_001259394.1.51167 WP_001259394.1.63137 WP_001259394.1.66357 WP_001259394.1.7856 WP_001259394.1.95308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]