SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J9YUC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J9YUC8
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily NosL/MerB-like 8.11e-28
Family NosL-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J9YUC8
Sequence length 167
Comment (tr|A0A1J9YUC8|A0A1J9YUC8_9BACI) Uncharacterized protein {ECO:0000313|EMBL:OJE16837.1} KW=Complete proteome OX=1120337 OS=Bacillus sp. EB422. GN=BAQ45_22340 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRTKYVMLAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGVMDNQFATEIILENGK
ALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWVSLEDATYVYDKTITTPMAYNVISF
KNKKDAESFVSNYKGKILSYKELAEHKWEMNKEMMGNPKKGNHGAHH
Download sequence
Identical sequences A0A136BIL1 A0A1J9YUC8 Q73DT7
gi|42779703|ref|NP_976950.1| WP_001259402.1.24759 WP_001259402.1.39001 WP_001259402.1.45089 WP_001259402.1.49802 WP_001259402.1.50770 WP_001259402.1.59052 WP_001259402.1.61944 WP_001259402.1.65758 WP_001259402.1.77902 WP_001259402.1.79043 WP_001259402.1.92347 WP_001259402.1.97617 222523.BCE_0624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]