SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1K0FX39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1K0FX39
Domain Number 1 Region: 5-157,252-390
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.92e-71
Family Capz alpha-1 subunit 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1K0FX39
Sequence length 396
Comment (tr|A0A1K0FX39|A0A1K0FX39_9BASI) Related to CAP1-F-actin capping protein alpha subunit {ECO:0000313|EMBL:SAM69303.1} KW=Complete proteome OX=307758 OS=Ustilago bromivora. GN=UBRO_00664 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MSANSSRLNEALSLLIQSPPGQTSQVYHDLRGILFDAESNATDKVDDAKLQSIAAVALEE
YNTQQLGTATLPSNDAAVIICQAGHVPGDTSDAGAGVKRYIHPKLGKTFLFNHVKRTTSD
VKDLTVADEKAEEKRKALEKALEEYVKDRYPDGVSSVFSISSAPVKAEEEDELAEKVKKA
AVEDAKTPAGNTAATGTEDADEKMDDETTATKEEIAEEKEEEENAVEDDPAEAVAASEAV
ENSTNTQTSSTTSAAPPAKTTFAIHHVGNRFNLSNFWSGRWRASYTLDPTVSPSTLTSTL
SVQVHYFENGNVQLNAAKPRTFHLTSDGDDPEKLAKEVVKVIAAHEDGWQKGLEESYDEL
AERAFKALRRQLPLTRQKIDWDKVLNYKLGDELSRA
Download sequence
Identical sequences A0A1K0FX39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]