SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1K0HFG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1K0HFG1
Domain Number 1 Region: 3-318
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-65
Family Capz beta-1 subunit 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1K0HFG1
Sequence length 322
Comment (tr|A0A1K0HFG1|A0A1K0HFG1_9BASI) Probable CAP2-F-actin capping protein, beta subunit {ECO:0000313|EMBL:SAM86065.1} KW=Complete proteome OX=307758 OS=Ustilago bromivora. GN=UBRO_08001 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MTDPLDLSLDLLRRLPPSKVEQNLESIVKLIPSYADDLYSSVDQPLKVKLDNSKHGAGRE
FLSCDYNKDGDSWRSWISDTYHPPISPDADDTPDGERGTRPSAPLRSLELKANDAFETYA
KLYYDNALSSVYLWDLDSDPSSLPNATVGGAQAPSTFAGVVLLKKSIGQDSGNGISGAWD
SIHVFEATERASGASKSSSTGNGASASYKLTSTVMLSLIRRDQGEEDPAELTPSSTKVGT
VEIAGSLTRQSEADYALPAFVSHVSNVGRMIEDMEAKMRNQLQEVYFGKTRDVVSHLRST
QSLEKERKARDLQKELMGLWKK
Download sequence
Identical sequences A0A1K0HFG1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]