SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1K1YLC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1K1YLC3
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00000017
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1K1YLC3
Sequence length 226
Comment (tr|A0A1K1YLC3|A0A1K1YLC3_9GAMM) Anti sigma-E protein RseA, N-terminal domain {ECO:0000313|EMBL:SFX62261.1} KW=Complete proteome; Reference proteome OX=1122209 OS=Marinospirillum alkaliphilum DSM 21637. GN=SAMN02745752_02287 OC=Oceanospirillaceae; Marinospirillum.
Sequence
MTEKLHQSLSSVMDGAGDDLELPRLLNAMQASDETSQQLSAKWRRYHLAQGVMRGELRNL
KDSSAAQVDISSAVMQALLQEDIPYTDAGAASDLGAFQSKVQQADPAPVAASVSEKRLDR
GQWFRGSALAASVALLVITGVQIFNSGSDPLTAPAAAPVAAQDFQPLTLPASYSPAFSSQ
VAQPLSGFSLVNFSAEPSRLQPCEAEKETFLPLFGPQAVQQVTAPR
Download sequence
Identical sequences A0A1K1YLC3
WP_084662190.1.40166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]