SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L1RQ38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L1RQ38
Domain Number 1 Region: 142-327
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.17e-61
Family DNA polymerase beta-like 0.0000000305
Further Details:      
 
Domain Number 2 Region: 14-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 2.22e-17
Family DNA polymerase beta, N-terminal domain-like 0.0000291
Further Details:      
 
Domain Number 3 Region: 85-140
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 4.58e-17
Family DNA polymerase beta-like, second domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L1RQ38
Sequence length 328
Comment (tr|A0A1L1RQ38|A0A1L1RQ38_CHICK) DNA polymerase beta {ECO:0000313|Ensembl:ENSGALP00000060902} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=POLB OC=Phasianidae; Phasianinae; Gallus.
Sequence
MSKRKAPQESLNQELANYERNVSRAIHKYNAYRKAASVISRYPSRIRSGAEAKKLDGVGA
KIAEKIDEFLSTGKLRKLEKIRQDDTSASINFLTRVTGIGPAAARKFVEEGIKTLEDLRK
NEHKLTHHQRIGLKYFEDFEKRIPREEMLQMQEIVLKEVKNVDPNYIATVCGSFRRGAES
SGDMDVLLTHPTFTSESSKQSKLLHQVIEQLEKVHFVTDVLSKGDTKFMGVCQLPNKEDG
TLYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRTHALEMGFTINEYTIRPLGVTGVA
GEALPVECEKDIFDYIQWKYREPKDRSE
Download sequence
Identical sequences A0A1L1RQ38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]