SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L5J885 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L5J885
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.0000034
Family Glycoprotein B-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L5J885
Sequence length 35
Comment (tr|A0A1L5J885|A0A1L5J885_HCMV) Glycoprotein B {ECO:0000313|EMBL:APO10828.1} OX=10359 OS=Human cytomegalovirus (HHV-5) (Human herpesvirus 5). GN=UL55 OC=Betaherpesvirinae; Cytomegalovirus. OH=9606
Sequence
RTRRSTSDNNTTHLSSMESVHNLVYAQLQFTYDTL
Download sequence
Identical sequences A0A1L5J871 A0A1L5J875 A0A1L5J876 A0A1L5J878 A0A1L5J879 A0A1L5J881 A0A1L5J883 A0A1L5J885 A0A1L5J886 A0A1L5J888 A0A1L5J889 A0A1L5J890 A0A1L5J891 A0A1L5J893 A0A1L5J894 A0A1L5J895 A0A1L5J898 A0A1L5J8A3 A0A1L5J8A7 A0A1L5J8B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]