SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L8FHM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8FHM6
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.59e-52
Family Capz beta-1 subunit 0.0000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8FHM6
Sequence length 190
Comment (tr|A0A1L8FHM6|A0A1L8FHM6_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT71080.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18037988mg OC=Xenopus.
Sequence
MTEQQLDCALDLMRRLPPQQIEKNLSDLIDLGGVSSVYLWDLDHGFAGVILIKKAGDGSK
KIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDET
VSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQSFADKSKQEALKNDL
MEALKRKQQS
Download sequence
Identical sequences A0A1L8FHM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]