SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L8GU89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8GU89
Domain Number 1 Region: 20-293
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-113
Family Capz alpha-1 subunit 0.000000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8GU89
Sequence length 298
Comment (tr|A0A1L8GU89|A0A1L8GU89_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT87371.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18021071mg OC=Xenopus.
Sequence
MGTSSQEKGAKKMADMEEQLSDDEKVRVAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLRE
GAAHAFAQYNLDQFTPVKVDGYDEQVLITEHGDLGNGRFLDPKNKVSFKFDHLRKEASDP
RPSDGENAIESWRNTVDTAVRSYVKEHYPNGVCTVYGKTIDGQQTIIACIESHQFQAKNF
WNGRWRSEWKFTITPSTTKVFGILKIQVHYYEDGNVQLVSHKDIEESLTVSNEVQTAKEF
IKIVEDAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A1L8GU89
XP_018111359.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]