SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9PVQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1L9PVQ1
Domain Number - Region: 43-70
Classification Level Classification E-value
Superfamily BEACH domain 0.0654
Family BEACH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9PVQ1
Sequence length 159
Comment (tr|A0A1L9PVQ1|A0A1L9PVQ1_ASPVE) Uncharacterized protein {ECO:0000313|EMBL:OJJ05506.1} KW=Complete proteome; Reference proteome OX=1036611 OS=Aspergillus versicolor CBS 583.65. GN=ASPVEDRAFT_856190 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MHLRTSYVALPQFDPVGEQGTFSLSTGTWHFTFNSPAAKQFESIYPLFPPVLVDNSIHGT
PIYRDLPEQHVIRSGASFSGASRCSSPPTDANIILRLPSPQLLGSLNWSCTPVVTRRRTQ
ECQGFQNNIGCCPRSMTNHQANNPIPTRFTRPPITVDSL
Download sequence
Identical sequences A0A1L9PVQ1
jgi|Aspve1|856190|CE651260_6893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]