SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9RR61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9RR61
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.85e-33
Family Co-chaperone p23-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9RR61
Sequence length 211
Comment (tr|A0A1L9RR61|A0A1L9RR61_ASPWE) Uncharacterized protein {ECO:0000313|EMBL:OJJ37425.1} KW=Complete proteome; Reference proteome OX=1073089 OS=Aspergillus wentii DTO 134E9. GN=ASPWEDRAFT_170906 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPELTQIHPEVTWAQRSSSTDAARNYLYVNIKAPDVAKEAADLNLSSNNISFTGESKKGY
KYQVSLDLFDAIDVENSKVNHSAREIEMVLRKKELKEEYWPRLTKEKQKLHFLKTDFDKW
VDEDEQDEAPEDDYANNFGGMGGMGDMGEQGGLGNIDFSKLGAGLEGMGGAGGMPDLSAM
GGEEEEDDEDMPELEEAEGTAPKSSKIQEVS
Download sequence
Identical sequences A0A1L9RR61
jgi|Aspwe1|170906|gm1.4841_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]