SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M2YGM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M2YGM8
Domain Number 1 Region: 55-106
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000902
Family Preprotein translocase SecE subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M2YGM8
Sequence length 116
Comment (tr|A0A1M2YGM8|A0A1M2YGM8_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:OJT94209.1} KW=Complete proteome; Reference proteome OX=1531428 OS=Candidatus Micrarchaeum sp. AZ1. GN=JJ59_04565 OC=Archaea; Candidatus Micrarchaeota; Candidatus Micrarchaeum.
Sequence
MVTQENIFALKIFKANAMALVQHVFNTAQLKINIQRAIYKRSYSIIGICMDMNVVKRLRS
FWTNSRHIINISYRPKNDEFKKTAKVIIIGILIVGVLGLILGIIISLAIAGNLSLI
Download sequence
Identical sequences A0A1L9GT68 A0A1M2YGM8 A0A218ZIY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]