SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M3D9D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M3D9D5
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily SPOC domain-like 1.22e-44
Family Ku70 subunit middle domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M3D9D5
Sequence length 286
Comment (tr|A0A1M3D9D5|A0A1M3D9D5_9SPHN) Non-homologous end joining protein Ku {ECO:0000256|HAMAP-Rule:MF_01875} KW=Complete proteome; Reference proteome OX=1895849 OS=Sphingomonas sp. 67-36. GN=BGO24_03225 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MPARAYWQGQIRLALVSIPVEIYSATRSGATVSFRQIHEPSGKRIHYEKVVDGIGPVDPD
EIMKGFEVSKGEYVLLDDEEIAGVKLESKRTLELTQFVDMTEIDAIYYDRPYYVVPADDL
ADEAFVVLREALRRAKKVGLGQLALRGREYVVALKPCGRGMVLETLRYADEVNKAAGFFR
DIPDTKPDADLLDLATTLIEKKTGKFDASEFHDRYVDALRELIARKRKSKSGKVALDEEE
RAPARGSNVIDLMAALKKSLDRPAAAPKPAAKKPAARKPATRRKSA
Download sequence
Identical sequences A0A1M3D9D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]