SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M4E8X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M4E8X7
Domain Number 1 Region: 25-132
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000288
Family Tissue inhibitor of metalloproteinases, TIMP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M4E8X7
Sequence length 217
Comment (tr|A0A1M4E8X7|A0A1M4E8X7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:SBO95168.1} OX=93944 OS=Nonomuraea gerenzanensis. GN=BN4615_P4684 OC=Nonomuraea.
Sequence
MLRFLALLALAASILAGLSTAAHACSCANLTPAQAVRHADAVFTGTVTGMREAGGLGRPR
VFTFRADQVYKGAPAAGFTLTTSADSASCGYAFERGGRYLVFAAAASSGPVVEGVELSSH
LCSGNVPLDPGTGPLRPGDERAAGHESLAGPVGPELVEVLGRPLPPVATGETHQAAGPLR
AERGAGVDRGWIAGGAVVVLAAAGTLLAFAARRRNAQ
Download sequence
Identical sequences A0A1M4E8X7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]