SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6K4R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6K4R8
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily YccV-like 1.14e-34
Family YccV-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M6K4R8
Sequence length 108
Comment (tr|A0A1M6K4R8|A0A1M6K4R8_9RHOB) Heat shock protein HspQ {ECO:0000313|EMBL:SHJ53888.1} KW=Complete proteome; Reference proteome OX=313368 OS=Maribius salinus. GN=SAMN04488012_11131 OC=Rhodobacteraceae; Maribius.
Sequence
MLSTRARYHLGQIVRHRKHPFRGVVFDVDPKFNNTEEWYESIPEEARPAKDQPYYHLLAE
NEQSYYVAYVSEQNLIADYSGEPVGHPDLPDLFGDIEDGTYPLQFAMN
Download sequence
Identical sequences A0A1H8DA60 A0A1M6K4R8
WP_073129417.1.14897 WP_073129417.1.39472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]