SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6KMF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6KMF8
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily CPE0013-like 6.54e-28
Family CPE0013-like 0.0011
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000129
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M6KMF8
Sequence length 126
Comment (tr|A0A1M6KMF8|A0A1M6KMF8_9FIRM) CxxC motif-containing protein {ECO:0000313|EMBL:SHJ60248.1} KW=Complete proteome; Reference proteome OX=1121950 OS=Hespellia stercorisuis DSM 15480. GN=SAMN02745243_00961 OC=Hespellia.
Sequence
METRELICIGCPMGCQLTIEMNDTEVVSVAGNTCPRGETYAKKEVTNPTRIVTSTVRVEG
GEMDMVSVKTREDIPKGKIFDCVHALKNVTVAAPVNIGDVVLRNAAGTGVDIVATRNVGV
PNQHGN
Download sequence
Identical sequences A0A1M6KMF8
WP_073106150.1.83441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]