SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6W3U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6W3U5
Domain Number 1 Region: 14-83
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0000000000183
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M6W3U5
Sequence length 208
Comment (tr|A0A1M6W3U5|A0A1M6W3U5_9BURK) Anti sigma-E protein, RseA {ECO:0000313|EMBL:SHK88462.1} KW=Complete proteome; Reference proteome OX=169427 OS=Paraburkholderia terricola. GN=SAMN05192548_104333 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MGSVSMQSQASSRGERLSAFVDGEFGEEHLNLNKFLSELDGEDRAGWSSYHLIGDALRSD
DLAVSPAVSRAFLSGFAARFENEPHVLAPEAMPIARRLLALRRRVVPAFAVAAAAATLTW
IVVPQLQGVPGGPGAAQVASVQSQGALQRVAMASAPAAAVQAVAQDANIIRDASLDQYLE
AHQQFAQQPAMPGSMPLIRAAAVTTQGQ
Download sequence
Identical sequences A0A1M6W3U5 A0A1X0MEN8
WP_073431816.1.1202 WP_073431816.1.61235 WP_073431816.1.94246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]