SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1M8A416 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M8A416
Domain Number 1 Region: 8-144,176-312
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-57
Family Capz alpha-1 subunit 0.0000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M8A416
Sequence length 318
Comment (tr|A0A1M8A416|A0A1M8A416_MALS4) Similar to S.cerevisiae protein CAP1 (Alpha subunit of the capping protein heterodimer (Cap1p and Cap2p)) {ECO:0000313|EMBL:SHO77161.1} KW=Complete proteome OX=1230383 OS=yeast). GN=MSYG_1502 OC=Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
Sequence
MSNVKDDDPTTQCLALVLEAPPGQQRNVLSDIQGILSSSIDADEVADRARPILEQHAHEQ
LLYVPIELDGQHDEAILCDAAKRGDVYLHPRLSCQFSYDPIKEAVGAVTACPRPTDTTEK
LRAAVDKKLSQYVYQHYQTGLTSTFALGSSIPSVIDEGSVAQPSESDGNETQANEQPEMQ
NQPSTLCMHIVGNKYNLRNFWAGRWRSTYVVDVNARAFSQARIQIQSHYFENGNVQMFAG
CQPDLPTLAVATDDELPEAIFSAIHAYEQAYQDRLYETTNLLRDGTFKALRRTLPITRQK
IDWDKVVSYKLGSELANK
Download sequence
Identical sequences A0A1M8A416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]