SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1N6F9Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1N6F9Y8
Domain Number 1 Region: 88-155
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.7e-26
Family Cyanase C-terminal domain 0.0000294
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.84e-19
Family Cyanase N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1N6F9Y8
Sequence length 156
Comment (tr|A0A1N6F9Y8|A0A1N6F9Y8_9BURK) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=60549 OS=Paraburkholderia phenazinium. GN=SAMN05444168_1390 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MTQSLHSPASREALTDTIMDAKLRKNLTFEQINEGTGLSLAFVTAALLGQHPLPADAAKV
VVDKLELGEDALRLLQAIPVRGSIPGGVPTDPTIYRFYEIVQVYGSTLKALVHEKLGDGI
ISAINFKLDFQVIDDPEGGKRAVITLDGKYLPTKPF
Download sequence
Identical sequences A0A1N6F9Y8
WP_074263606.1.65178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]