SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P8FFL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P8FFL0
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Barstar-related 8.5e-21
Family Barstar-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1P8FFL0
Sequence length 95
Comment (tr|A0A1P8FFL0|A0A1P8FFL0_9PROT) Uncharacterized protein {ECO:0000313|EMBL:APV48892.1} KW=Complete proteome; Reference proteome OX=1904640 OS=Betaproteobacteria bacterium GR16-43. GN=BWI17_03860 OC=Bacteria; Proteobacteria; Betaproteobacteria.
Sequence
MSGDELTIDVGFASTGNSLHEMFAAVLGFPSYYGMNWDAFWDCVRDSEQSSMPKHLVLTG
MSHLKERLPEDARKLRDIVSDLKQKRPELKVSLRE
Download sequence
Identical sequences A0A1P8FFL0
WP_076018977.1.98422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]