SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P8YC87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P8YC87
Domain Number 1 Region: 40-125
Classification Level Classification E-value
Superfamily Barstar-related 0.00000000000000379
Family Barstar-related 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1P8YC87
Sequence length 159
Comment (tr|A0A1P8YC87|A0A1P8YC87_9NOCA) Barstar family protein {ECO:0000313|EMBL:AQA21729.1} KW=Complete proteome; Reference proteome OX=1805827 OS=Rhodococcus sp. MTM3W5.2. GN=BTZ20_1717 OC=Rhodococcus.
Sequence
MTTVDGFITDRTGPVAGMLTGTAPVGDTLAYALSERGYTVRVVRAPKMRTTDALFDEFAA
ALQFPYYFGANKDAFDECLRDADDWLGESPGLVLMVRDAADLLADEPGELGWFVDAVEDG
AKDRTDGLLRVILQADRPSASALARRWTSAGGELAWVEP
Download sequence
Identical sequences A0A1P8YC87
WP_077040935.1.62248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]