SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q1N5D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q1N5D9
Domain Number 1 Region: 65-207
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 5.75e-59
Family Glycoprotein B-like 0.00011
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 3.4e-22
Family Glycoprotein B-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q1N5D9
Sequence length 207
Comment (tr|A0A1Q1N5D9|A0A1Q1N5D9_9GAMA) Glycoprotein B {ECO:0000313|EMBL:AQM49841.1} OX=1954226 OS=Diphylla ecaudata gammaherpesvirus. GN=gB OC=Gammaherpesvirinae.
Sequence
SIIRYHTQPKLYAEPGPLWGTYRTRTTVNCEVVDMIARSAEPYDYFVTALGDTVETSPFC
HNTTSCPFVGDAILVTQCIDVDQNSVNIHKSLKTCYSRPPVTFKFLNSSTLFRGQLGPRN
EILLTSNHVETCQDNAEHYFIAKNETYYFKDYTYVKTLNVTDILTLDTFITLNISFIENI
DFKVIELYTAAEKKLSNVFDLETMFRE
Download sequence
Identical sequences A0A1Q1N5D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]