SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q2ZSS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q2ZSS1
Domain Number 1 Region: 59-165
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.96e-36
Family Frataxin-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q2ZSS1
Sequence length 176
Comment (tr|A0A1Q2ZSS1|A0A1Q2ZSS1_ZYGRO) Uncharacterized protein {ECO:0000313|EMBL:GAV46517.1} KW=Complete proteome OX=4956 OS=Zygosaccharomyces rouxii (Candida mogii). GN=ZYGR_0A01090 OC=Zygosaccharomyces.
Sequence
MIRSTFVRASRLGRTCTAASAIRRASLLPIRKWNYPHPQLHAQRFYAESFTLGDEIPPEV
TNLSFQTYHEQADTFLESLSDQLEALSQKYPESVPDVELTQGVMQLELGGIGSYVINKQP
PNKQIWLASPVSGPNRFDFYKNEWISLRDGSKLLDILNEEINQAVTEENVTLTPSD
Download sequence
Identical sequences A0A1Q2ZSS1 C5DPD4
gnl|GLV|ZYRO0A02464g XP_002494478.1.66507 559307.ZYRO0A02464g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]