SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q3C9D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3C9D6
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-71
Family Capz beta-1 subunit 0.000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3C9D6
Sequence length 256
Comment (tr|A0A1Q3C9D6|A0A1Q3C9D6_CEPFO) F_actin_cap_B domain-containing protein {ECO:0000313|EMBL:GAV76683.1} KW=Complete proteome; Reference proteome OX=3775 OS=Cephalotus follicularis (Albany pitcher plant). GN=CFOL_v3_20156 OC=Pentapetalae; rosids; fabids; Oxalidales; Cephalotaceae; Cephalotus.
Sequence
MEAAMGLMRRIHPKNTDMALSALLSLLPHHSSDLLSQVDQPLQVLFDVECGKEFILCEYN
RDADSYRSPWSNKYHPALEDAPYPSSELRKLEIEANDIFAIYRDQYYEGGISSVYMWEDG
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGAEEEGIAHYCLTSTVMLSLTT
NDESSGSFCLSGSIRRQMNMDLSVAEGHLCNMGRMIEEMESKLRNSLDQVYFGKTREMVC
TLRPPFEVVQMRLPDS
Download sequence
Identical sequences A0A1Q3C9D6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]