SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q3FF96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3FF96
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-96
Family Capz beta-1 subunit 0.00000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3FF96
Sequence length 275
Comment (tr|A0A1Q3FF96|A0A1Q3FF96_CULTA) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:JAV26224.1} OX=7177 OS=Culex tarsalis (Encephalitis mosquito). GN= OC=Culicidae; Culicinae; Culicini; Culex; Culex.
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLIDLIDLAPALCEDLLTSIDQPLKIAKDKETGKDYL
LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIEANHAFDQYREMYYEGGVSSAY
LWDLDHGFAGVILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTH
KQSSGTINLGGSLTRQIEQDAPVSESSPHIANIGRIVEDMENKIRNTLNEIYFGKTKDIV
NGLRSIQSLADTNQQAAMKKDLAAALLRRTGKGEN
Download sequence
Identical sequences A0A1Q3FF96 B0WTE9
7176.CPIJ010373-PA CPIJ010373|F-actin XP_001870869.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]