SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3MT66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q3MT66
Domain Number - Region: 21-63
Classification Level Classification E-value
Superfamily BEACH domain 0.0445
Family BEACH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3MT66
Sequence length 133
Comment (tr|A0A1Q3MT66|A0A1Q3MT66_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OJU72421.1} KW=Complete proteome; Reference proteome OX=1895695 OS=Acinetobacter sp. 39-4. GN=BGN93_13630 OC=Moraxellaceae; Acinetobacter.
Sequence
MMLGLLGCESFEDYKSKDSNVITEFDSYIIENDNQKNKRDLNKSSTYIRKSEINLNKQKM
IETCKKLVLSNVPKQKTVSFNENLRGNYYINQKTGDVYLYLEFCAENEQGNAQEFKGKCV
FSIDGQTQVNIFE
Download sequence
Identical sequences A0A1Q3MT66 N8QS81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]