SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3YBK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3YBK2
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00000000000405
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3YBK2
Sequence length 195
Comment (tr|A0A1Q3YBK2|A0A1Q3YBK2_9BURK) Uncharacterized protein {ECO:0000313|EMBL:OJW99242.1} KW=Complete proteome OX=1895727 OS=Burkholderiales bacterium 66-26. GN=BGO73_05380 OC=Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales.
Sequence
MNDEDVMRERLSALADGELVGLECHETLAYAQTEQGQASWQAYHVIGDVMRGVPAVPMLD
TAMLERLRGQIAQEVLPLRPGVASAAVSRVGRADARAANASVMHWKLAAGFASLTAAVAL
GWTAYAGFGPRTGGGTQIAVASPAQGAAMVVDGHNVIRDPRLDELIRQTGRYGGSSQMTR
DSFLRNASLEAPPKH
Download sequence
Identical sequences A0A1D2U2W5 A0A1Q3YBK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]