SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q4E359 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4E359
Domain Number 1 Region: 54-127
Classification Level Classification E-value
Superfamily YdhA-like 0.0000000000000103
Family YdhA-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4E359
Sequence length 128
Comment (tr|A0A1Q4E359|A0A1Q4E359_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:OJY50995.1} KW=Complete proteome; Reference proteome OX=1895850 OS=Sphingomonas sp. 67-41. GN=BGP17_21735 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MRLTLTALLVLGACSSPQPAVDRNVVQAETTNITDDASPAPVDKAPIAGDAGSAVRFRCM
DGVRIAARFDTDKDIATVTRDGRTFVLPQQRMASGIRYSDGSTTFEGKGDAMSFEAPGQP
PIACTVIR
Download sequence
Identical sequences A0A1Q4E359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]