SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q4GL45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4GL45
Domain Number 1 Region: 55-172
Classification Level Classification E-value
Superfamily NosL/MerB-like 2.62e-36
Family NosL-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4GL45
Sequence length 173
Comment (tr|A0A1Q4GL45|A0A1Q4GL45_9PROT) Nitrous oxide reductase accessory protein NosL {ECO:0000313|EMBL:OJZ16146.1} KW=Complete proteome OX=1895859 OS=Thiobacillus sp. 63-78. GN=BGP20_01050 OC=Thiobacillaceae; Thiobacillus.
Sequence
MTLTRRTLILAALTTTLLAACGQASGPTAVAPLEITRGTSCALDGMLLADYPGPKAQIFY
AGQTEPDFFCDTIEMFHLYLTPEQVREVRGIFVQDMGKADWDDPHGHWVDAKSAYYVYGS
KREGSMGPTIASFALEQDATKFAAEYGGKVTRFADIKPDMVVLDGGVVHDSHM
Download sequence
Identical sequences A0A1Q4GL45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]